PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT24079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 237aa    MW: 27321.3 Da    PI: 6.7994
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT24079genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM177.92.7e-5591391129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
               +ppGfrFhPtdeelv++yL+kkv++++++l +vik+vd+yk+ePwdL++      ++e+++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk++++ k+
  EMT24079   9 VPPGFRFHPTDEELVDYYLRKKVASRRIDL-NVIKDVDLYKIEPWDLQEkcriGPEEEQSDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKPIYA-KH 107
               69****************************.99**************95343322335669*************************************.89 PP

       NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                lvg++ktLv+ykgrap+g+k+dW+mheyrle
  EMT24079 108 CLVGMRKTLVYYKGRAPNGQKSDWIMHEYRLE 139
               9*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.62E-576144IPR003441NAC domain
PROSITE profilePS5100553.1939163IPR003441NAC domain
PfamPF023655.7E-2910138IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MGSNTQPQVP PGFRFHPTDE ELVDYYLRKK VASRRIDLNV IKDVDLYKIE PWDLQEKCRI  60
GPEEEQSDWY FFSHKDKKYP TGTRTNRATA AGFWKATGRD KPIYAKHCLV GMRKTLVYYK  120
GRAPNGQKSD WIMHEYRLET NENGPPQASY SYNDHQINVH HAQHHHVQLI DHAVDDQAAT  180
DWRVLDKFVA SQLSNDAAKG VDYAHEGDIL QLNEKAQELA TDYASTSTSS SQVDPWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-5031389140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6934251e-162JQ693425.1 Brachypodium distachyon SWN4 (SWN4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001304791.11e-103NAC domain-containing protein 7-like
RefseqXP_014754958.11e-103PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX23e-89NAC7_ARATH; NAC domain-containing protein 7
TrEMBLM8BQ350.0M8BQ35_AEGTA; NAC domain-containing protein 7
STRINGMLOC_53086.21e-105(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25943791
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.19e-80NAC 007